Opossum (Didelphis virginiana) "little" and "big" gastrins

Yasuhisa Shinomura, John Eng, Satish C. Rattan, Rosalyn S. Yalow

Research output: Contribution to journalArticlepeer-review

6 Scopus citations

Abstract

1. 1. "Little" gastrin from most mammalian species are 17 amino acid peptides and the precursor "big" gastrins are 34 amino acid peptides. 2. 2. "Little" gastrins of the New World hystricomorphs, guinea-pig and chinchilla, are 16 amino acid peptides due to deletion of a glutamic acid in the region 6-9 from their NH2-terminus and the corresponding "big" gastrins are 33 amino acid peptides. 3. 3. Antral gastrins from the opossum, a New World marsupial, have a glutamic acid deletion in the same region as the hystricomorph gastrins. 4. 4. Opossum "big" gastrin is a 33 amino acid peptide with the following sequence: 〈ELGPQDLPYLTADLSKKQGPWLEEEEAYGWMDF#.

Original languageEnglish
Pages (from-to)239-242
Number of pages4
JournalComparative Biochemistry and Physiology - B Biochemistry and Molecular Biology
Volume96
Issue number2
DOIs
StatePublished - 1990
Externally publishedYes

Fingerprint

Dive into the research topics of 'Opossum (Didelphis virginiana) "little" and "big" gastrins'. Together they form a unique fingerprint.

Cite this